PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC066488.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ZF-HD
Protein Properties Length: 184aa    MW: 20118.5 Da    PI: 6.867
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC066488.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.41.5e-3284138358
   ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                    v+YkeClkNhAa++Gg+a+DGCgEfmps geegt++al+C+AC+CHRnFHR+eve
  EcC066488.10  84 VVKYKECLKNHAAAMGGTAMDGCGEFMPS-GEEGTIEALTCSACNCHRNFHRKEVE 138
                   689*************************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047709.5E-3085137IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.2E-3286137IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.57687136IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257746.0E-2289139IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MELPSQDTDI PIPINSSFGG GHGGHLIHQP QQHDPSSAIA SHNNHINLPR IPSNGPPPQP  60
PPPPPPLEEP QPQHQHVMPY KKVVVKYKEC LKNHAAAMGG TAMDGCGEFM PSGEEGTIEA  120
LTCSACNCHR NFHRKEVEGG GDDHEHQWYN QTPSHNLMNK SGRKFILGHQ IHPKNVNVLG  180
GHEP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010065227.11e-132PREDICTED: zinc-finger homeodomain protein 4-like
SwissprotQ9M9S07e-38ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLA0A059B8L61e-132A0A059B8L6_EUCGR; Uncharacterized protein
STRINGPOPTR_0003s00800.11e-44(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94428114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.27e-34homeobox protein 31